Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WISP1 Peptide - N-terminal region

WISP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CCN4, WISP1c, WISP1i, WISP1tc

UniProt

O95388

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WISP1 Rabbit Polyclonal Antibody (orb585798) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003873

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOCS2 Antibody
CSB-PA014706ESR1HU-01 50 μL

MOCS2 Antibody

Sign In for Pricing
View Details
MOCS2 Antibody
CSB-PA014706ESR1HU-02 100 µL

MOCS2 Antibody

Sign In for Pricing
View Details
Stromal Cell Derived Factor 2 (SDF2, Stromal Cell-derived Factor 2, SDF-2) (MaxLight 650)
138398-ML650 100 µL

Stromal Cell Derived Factor 2 (SDF2, Stromal Cell-derived Factor 2, SDF-2) (MaxLight 650)

Sign In for Pricing
View Details
SNAI2 siRNA (Mouse)
CRM3796-01 15 nmol

SNAI2 siRNA (Mouse)

Sign In for Pricing
View Details
SNAI2 siRNA (Mouse)
CRM3796-02 30 nmol

SNAI2 siRNA (Mouse)

Sign In for Pricing
View Details
NRAS Antibody
MBS8591118-01 0.1 mg

NRAS Antibody

Sign In for Pricing
View Details