Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WISP1 Peptide - N-terminal region

WISP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CCN4, WISP1c, WISP1i, WISP1tc

UniProt

O95388

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WISP1 Rabbit Polyclonal Antibody (orb585798) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003873

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Euphol
B3301-1 1 mg

Euphol

Sign In for Pricing
View Details
PTF1A Antibody, HRP conjugated
MBS7052346-01 0.05 mg

PTF1A Antibody, HRP conjugated

Sign In for Pricing
View Details
PTF1A Antibody, HRP conjugated
MBS7052346-02 0.1 mg

PTF1A Antibody, HRP conjugated

Sign In for Pricing
View Details
PTF1A Antibody, HRP conjugated
MBS7052346-03 5x 0.1 mg

PTF1A Antibody, HRP conjugated

Sign In for Pricing
View Details
LOC689574 3'UTR Luciferase Stable Cell Line
TU211927 1.0 mL

LOC689574 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
DDI1 Protein Vector (Mouse) (pPM-C-His)
PV171057 500 ng

DDI1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details