CD5L Peptide - N-terminal region
CD5L Peptide - N-terminal region
Product Specifications
Product Name Alternative
AIM, API6, CT-2, hAIM, PRO229, Spalpha, SP-ALPHA
UniProt
O43866
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CD5L Rabbit Polyclonal Antibody (orb586086) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_005885
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DGWDIKDVAVLCRELGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
FTUB909-4bags 250 PCS/Pack - 4 PKS/Box
BeyoGoldTM Screw Cap Sample Tube
Sign In for Pricing
View Details 
MBS6368428-01 0.1 mL
ABI2 (ARGBPIA, Abl Interactor 2, Abelson Interactor 2, Abl-binding Protein 3, Arg-binding Protein 1) (AP)
Sign In for Pricing
View Details MBS6368428-02 5x 0.1 mL
ABI2 (ARGBPIA, Abl Interactor 2, Abelson Interactor 2, Abl-binding Protein 3, Arg-binding Protein 1) (AP)
Sign In for Pricing
View Details