FFAR2 Peptide - C-terminal region
FFAR2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
FFA2R, GPR43
UniProt
O15552
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FFAR2 Rabbit Polyclonal Antibody (orb586176) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_005297
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A04803-2-Fluoro488 100 µg/Vial
Anti-MDH2 Antibody Picoband® Fluoro488 Conjugated
Sign In for Pricing
View Details 
TRV-0059120-01 20 µL
Polyclonal Antibody to Xeroderma Pigmentosum, Complementation Group A (XPA)
Sign In for Pricing
View Details TRV-0059120-02 100 µL
Polyclonal Antibody to Xeroderma Pigmentosum, Complementation Group A (XPA)
Sign In for Pricing
View Details