Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FFAR2 Peptide - C-terminal region

FFAR2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FFA2R, GPR43

UniProt

O15552

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FFAR2 Rabbit Polyclonal Antibody (orb586176) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005297

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLH Rabbit pAb, AE conjugated
orb2847167 100 µL

KLH Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
Canine Myomesin 1 (MYOM1) ELISA Kit
MBS9394096-01 48 Well

Canine Myomesin 1 (MYOM1) ELISA Kit

Sign In for Pricing
View Details
Canine Myomesin 1 (MYOM1) ELISA Kit
MBS9394096-02 96 Well

Canine Myomesin 1 (MYOM1) ELISA Kit

Sign In for Pricing
View Details
Canine Myomesin 1 (MYOM1) ELISA Kit
MBS9394096-03 5x 96 Well

Canine Myomesin 1 (MYOM1) ELISA Kit

Sign In for Pricing
View Details
Canine Myomesin 1 (MYOM1) ELISA Kit
MBS9394096-04 10x 96 Well

Canine Myomesin 1 (MYOM1) ELISA Kit

Sign In for Pricing
View Details
Interferon gamma (IFNg) (Biotin) discontinued
I7662-16D-01 25 µg

Interferon gamma (IFNg) (Biotin) discontinued

Sign In for Pricing
View Details