Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DGCR6 Peptide - C-terminal region

DGCR6 Peptide - C-terminal region

Product Specifications

UniProt

Q14129

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DGCR6 Rabbit Polyclonal Antibody (orb586254) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005666

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: REEQRAMDQKIVLELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neostigmine hydroxide
orb1740430-01 25 mg

Neostigmine hydroxide

Sign In for Pricing
View Details
Neostigmine hydroxide
orb1740430-02 50 mg

Neostigmine hydroxide

Sign In for Pricing
View Details
Neostigmine hydroxide
orb1740430-03 100 mg

Neostigmine hydroxide

Sign In for Pricing
View Details
TRIM29 Protein Vector (Human) (pPM-C-HA)
PV059271 500 ng

TRIM29 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
2,6-Dibromo-3-nitropyridine
sc-322092 1 g

2,6-Dibromo-3-nitropyridine

Sign In for Pricing
View Details
Rabbit Polyclonal UGT1A6 Antibody [DyLight 650]
NBP2-97897C 0.1 mL

Rabbit Polyclonal UGT1A6 Antibody [DyLight 650]

Sign In for Pricing
View Details