DGCR6 Peptide - C-terminal region
DGCR6 Peptide - C-terminal region
Product Specifications
UniProt
Q14129
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DGCR6 Rabbit Polyclonal Antibody (orb586254) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_005666
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: REEQRAMDQKIVLELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
DNG-L041 10 mL
DiagNano™ Green Fluorescent, Amine Silica Nanoparticles, 30 nm
Sign In for Pricing
View Details 
GTR15203767 1 Vial
Lentiviral mouse Pced1a shRNA (UAS) - Lentiviral mouse Pced1a shRNA (UAS) plasmid
Sign In for Pricing
View Details 
GTR15357642 1 Vial
Lentiviral human CTDNEP1 sgRNA gene knockout kit - Lentiviral human CTDNEP1 sgRNA gene knockout kit (25)
Sign In for Pricing
View Details MBS1430982-01 0.02 mg (E-Coli)
Recombinant Nitrosococcus oceani Ribonuclease P protein component (rnpA)
Sign In for Pricing
View Details MBS1430982-02 0.1 mg (E-Coli)
Recombinant Nitrosococcus oceani Ribonuclease P protein component (rnpA)
Sign In for Pricing
View Details