Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIGA Peptide - middle region

PIGA Peptide - middle region

Product Specifications

Product Name Alternative

GPI3, PNH1, PIG-A, MCAHS2

UniProt

P37287

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIGA Rabbit Polyclonal Antibody (orb588335) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002632.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFTPDPFRRHDSITIVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Intercellular Adhesion Molecule 1 (ICAM-1) ELISA Kit
MBS268575-01 48 Well

Mouse Intercellular Adhesion Molecule 1 (ICAM-1) ELISA Kit

Sign In for Pricing
View Details
Mouse Intercellular Adhesion Molecule 1 (ICAM-1) ELISA Kit
MBS268575-02 96 Well

Mouse Intercellular Adhesion Molecule 1 (ICAM-1) ELISA Kit

Sign In for Pricing
View Details
Mouse Intercellular Adhesion Molecule 1 (ICAM-1) ELISA Kit
MBS268575-03 5x 96 Well

Mouse Intercellular Adhesion Molecule 1 (ICAM-1) ELISA Kit

Sign In for Pricing
View Details
Mouse Intercellular Adhesion Molecule 1 (ICAM-1) ELISA Kit
MBS268575-04 10x 96 Well

Mouse Intercellular Adhesion Molecule 1 (ICAM-1) ELISA Kit

Sign In for Pricing
View Details
RABIF Rabbit pAb, BF700 conjugated
orb2862547 100 µL

RABIF Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Mouse Heme Oxygenase 1 (HO1) ELISA Kit
YP-W22462-01 48 Tests

Mouse Heme Oxygenase 1 (HO1) ELISA Kit

Sign In for Pricing
View Details