Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIGA Peptide - middle region

PIGA Peptide - middle region

Product Specifications

Product Name Alternative

GPI3, PNH1, PIG-A, MCAHS2

UniProt

P37287

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIGA Rabbit Polyclonal Antibody (orb588335) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002632.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFTPDPFRRHDSITIVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Murine Granulocyte Macrophage-Colony Stimulating Factor protein
orb176049-01 2 µg

Murine Granulocyte Macrophage-Colony Stimulating Factor protein

Sign In for Pricing
View Details
Murine Granulocyte Macrophage-Colony Stimulating Factor protein
orb176049-02 10 µg

Murine Granulocyte Macrophage-Colony Stimulating Factor protein

Sign In for Pricing
View Details
Dgat2 3'UTR Luciferase Stable Cell Line
TU105091 1.0 mL

Dgat2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Calpain 1 Mouse Monoclonal Antibody (Fluoro647)
orb3084981 100 µg

Calpain 1 Mouse Monoclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
OR10S1 Rabbit Polyclonal Antibody (FITC)
orb2085327 100 µL

OR10S1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
CD47 Antibody
orb1312326-01 30 µL

CD47 Antibody

Sign In for Pricing
View Details