GCFC2 Peptide - middle region
GCFC2 Peptide - middle region
Product Specifications
Product Name Alternative
GCF, TCF9, DNABF, C2orf3
UniProt
A4UHR0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GCFC2 Rabbit Polyclonal Antibody (orb589288) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001188263.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DILQKQKKVFEEVQDDFCNIQNILLKFQQWREKFPDSYYEAFISLCIPKL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
034708-APC 200 µL
DNAJC11, NT (DNAJC11, DnaJ homolog subfamily C member 11) (APC) discontinued
Sign In for Pricing
View Details 
MBS6302136-01 0.1 mL
Ggt1, NT (Ggt1, Ggt, Gamma-glutamyltranspeptidase 1, Gamma-glutamyltransferase 1, Glutathione hydrolase 1, Leukotriene-C4 hydrolase, CD224, Gamma-glutamyltranspeptidase 1 heavy chain, Gamma-glutamyltranspeptidase 1 light chain) (MaxLight 750)
Sign In for Pricing
View Details MBS6302136-02 5x 0.1 mL
Ggt1, NT (Ggt1, Ggt, Gamma-glutamyltranspeptidase 1, Gamma-glutamyltransferase 1, Glutathione hydrolase 1, Leukotriene-C4 hydrolase, CD224, Gamma-glutamyltranspeptidase 1 heavy chain, Gamma-glutamyltranspeptidase 1 light chain) (MaxLight 750)
Sign In for Pricing
View Details MBS6357965-01 0.1 mL
Transglutaminase, CT (Tissue transglutaminase, TGase C, TGC, TG(C), Transglutaminase-2, TGase-H, TGM2) (MaxLight 750)
Sign In for Pricing
View Details