GCFC2 Peptide - middle region
GCFC2 Peptide - middle region
Product Specifications
Product Name Alternative
GCF, TCF9, DNABF, C2orf3
UniProt
A4UHR0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GCFC2 Rabbit Polyclonal Antibody (orb589288) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001188263.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DILQKQKKVFEEVQDDFCNIQNILLKFQQWREKFPDSYYEAFISLCIPKL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1097103-01 0.02 mg (E-Coli)
Recombinant Pseudomonas aeruginosa Pantothenate synthetase (panC)
Sign In for Pricing
View Details MBS1097103-02 0.02 mg (Yeast)
Recombinant Pseudomonas aeruginosa Pantothenate synthetase (panC)
Sign In for Pricing
View Details MBS1097103-03 0.1 mg (E-Coli)
Recombinant Pseudomonas aeruginosa Pantothenate synthetase (panC)
Sign In for Pricing
View Details MBS1097103-04 0.1 mg (Yeast)
Recombinant Pseudomonas aeruginosa Pantothenate synthetase (panC)
Sign In for Pricing
View Details