ZNF106 Peptide - N-terminal region
ZNF106 Peptide - N-terminal region
Product Specifications
Product Name Alternative
SH3BP3, ZFP106, ZNF474
UniProt
Q0VGA6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF106 Rabbit Polyclonal Antibody (orb589295) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001271235.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: STNNWNYSGPGDKFQPGRNRNSNCQMEDMTMLWNKKSNKSNKYSHDRYNW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS604604-01 0.1 mg
T-complex Protein 1 epsilon (T-complex Protein 1 epsilon Subunit, TCP1 epsilon, TCP1-epsilon, TCP-1 epsilon, Chaperonin Containing TCP1 epsilon, Chaperonin-containing TCP-1 epsilon, CCT epsilon, CCT-epsilon, CCTE, Chaperonin Containing TCP1 Subunit 5, Cha
Sign In for Pricing
View Details MBS604604-02 5x 0.1 mg
T-complex Protein 1 epsilon (T-complex Protein 1 epsilon Subunit, TCP1 epsilon, TCP1-epsilon, TCP-1 epsilon, Chaperonin Containing TCP1 epsilon, Chaperonin-containing TCP-1 epsilon, CCT epsilon, CCT-epsilon, CCTE, Chaperonin Containing TCP1 Subunit 5, Cha
Sign In for Pricing
View Details 
