Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINA7 Peptide - middle region

SERPINA7 Peptide - middle region

Product Specifications

Product Name Alternative

TBG

UniProt

P05543

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERPINA7 Rabbit Polyclonal Antibody (orb589317) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000345.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KELELQIGNALFIGKHLKPLAKFLNDVKTLYETEVFSTDFSNISAAKQEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP5J Protein Vector (Human) (pPM-N-D-C-His)
PV325257 500 ng

ATP5J Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
Sodium 3-nitrobenzenesulfonate
MBS3615953-01 5 mg

Sodium 3-nitrobenzenesulfonate

Sign In for Pricing
View Details
Sodium 3-nitrobenzenesulfonate
MBS3615953-02 10 mg

Sodium 3-nitrobenzenesulfonate

Sign In for Pricing
View Details
Sodium 3-nitrobenzenesulfonate
MBS3615953-03 25 mg

Sodium 3-nitrobenzenesulfonate

Sign In for Pricing
View Details
Sodium 3-nitrobenzenesulfonate
MBS3615953-04 50 mg

Sodium 3-nitrobenzenesulfonate

Sign In for Pricing
View Details
Sodium 3-nitrobenzenesulfonate
MBS3615953-05 100 mg

Sodium 3-nitrobenzenesulfonate

Sign In for Pricing
View Details