Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINA7 Peptide - middle region

SERPINA7 Peptide - middle region

Product Specifications

Product Name Alternative

TBG

UniProt

P05543

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERPINA7 Rabbit Polyclonal Antibody (orb589317) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000345.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KELELQIGNALFIGKHLKPLAKFLNDVKTLYETEVFSTDFSNISAAKQEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

T23F2.3 Antibody
orb802181 2 mg

T23F2.3 Antibody

Sign In for Pricing
View Details
Mouse Svbp Pre-designed siRNA Set B
SI114097B 1 Each

Mouse Svbp Pre-designed siRNA Set B

Sign In for Pricing
View Details
Liquiritin
SM2097-5mg 5 mg

Liquiritin

Sign In for Pricing
View Details
WNK4 (N) Antibody, Rabbit Polyclonal
orb387217 100 µL

WNK4 (N) Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Pot Dichro A/T Std 600mg/L w/ 0.005M Sulph Acid 2x Blanks in Cuvs - PK3
RSPEC-EP0061X2BU 3 / PCK

Pot Dichro A/T Std 600mg/L w/ 0.005M Sulph Acid 2x Blanks in Cuvs - PK3

Sign In for Pricing
View Details
PVRL2 Recombinant Protein (Mouse)
RP165935 100 µg

PVRL2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details