Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX2 Peptide - middle region

COX2 Peptide - middle region

Product Specifications

Product Name Alternative

COII, MTCO2

UniProt

H9E7T7

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COX2 Rabbit Polyclonal Antibody (orb55795) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

YP_003024029.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Tumor Necrosis Factor Alpha Induced Protein 2 ELISA Kit
IHUTNFAIP2KT 1 Each

Human Tumor Necrosis Factor Alpha Induced Protein 2 ELISA Kit

Sign In for Pricing
View Details
ELK1 recombinant monoclonal antibody
A5263 100ul X 3

ELK1 recombinant monoclonal antibody

Sign In for Pricing
View Details
RGMA (RGM Domain Family, Member A, RGM) (HRP)
MBS6183339-01 0.1 mL

RGMA (RGM Domain Family, Member A, RGM) (HRP)

Sign In for Pricing
View Details
RGMA (RGM Domain Family, Member A, RGM) (HRP)
MBS6183339-02 5x 0.1 mL

RGMA (RGM Domain Family, Member A, RGM) (HRP)

Sign In for Pricing
View Details
LRRC59 Rabbit Polyclonal Antibody (HRP)
orb2113283 100 µL

LRRC59 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Pig Cytochrome P450 26A1 (CYP26A1) ELISA Kit
abx360726 96 Well

Pig Cytochrome P450 26A1 (CYP26A1) ELISA Kit

Sign In for Pricing
View Details