COX2 Peptide - middle region
COX2 Peptide - middle region
Product Specifications
Product Name Alternative
COII, MTCO2
UniProt
H9E7T7
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with COX2 Rabbit Polyclonal Antibody (orb55795) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
YP_003024029.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
353052 96 Tests
Stem Cell Factor (SCF), BioAssayTM ELISA Kit (Mouse)
Sign In for Pricing
View Details K2347207 1.0 µg DNA
TCEAL6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
Sign In for Pricing
View Details 
134756-ML405 100 µL
TRIM5 (Tripartite Motif-containing Protein 5, RING Finger Protein 88, RNF88) (MaxLight 405) discontinued
Sign In for Pricing
View Details EKU11225 96 Tests
Mouse Matrix Metalloproteinase 2 (MMP2) Mini sample ELISA Kit
Sign In for Pricing
View Details K7159502 1.0 µg DNA
Gpr151 sgRNA CRISPR Lentivector (Rat) (Target 1)
Sign In for Pricing
View Details ![NKCC1 (SLC12A2) Mouse Monoclonal Antibody [Clone ID: N161/20]](https://cdn.genprice.uk/products/937/68dd1898061270361e8fb44a/imageurl/75-229.webp)
75-229 100 µL
NKCC1 (SLC12A2) Mouse Monoclonal Antibody [Clone ID: N161/20]
Sign In for Pricing
View Details