LAT Peptide - middle region
LAT Peptide - middle region
Product Specifications
Product Name Alternative
LAT1, pp36
UniProt
O43561
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LAT Rabbit Polyclonal Antibody (orb589322) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001014987.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15278776 1 Vial
Lentiviral mouse 3110009E18Rik shRNA (UAS) - Lentiviral mouse 3110009E18Rik shRNA (UAS, iRFP) plasmid
Sign In for Pricing
View Details