GBA3 Peptide - N-terminal region
GBA3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CBGL1, GLUC, KLrP, MGC104276, MGC126878
UniProt
Q9H227
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GBA3 Rabbit Polyclonal Antibody (orb583590) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_066024
Preservative
Lyophilized powder
AA Sequence
LTHYRFSLSWSRLLPDGTTGFINQKGIDYYNKIIDDLLKNGVTPIVTLYH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![SAP97 Recombinant Rabbit Monoclonal Antibody [JE39-74]](https://cdn.genprice.uk/products/992/68dd1c8c061270361ea81c25/imageurl/ha721502.webp)
HA721502 100 µL
SAP97 Recombinant Rabbit Monoclonal Antibody [JE39-74]
Sign In for Pricing
View Details 
BNUM1556-50 1x 50 µL
Ep-CAM / CD326 (Epithelial Marker) (EGP40/1556R), 1mg/mL
Sign In for Pricing
View Details 
BNC681398-500 1x 500 µL
BRCA1 (Breast Marker) (BRCA1/1398), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 