GBA3 Peptide - N-terminal region
GBA3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CBGL1, GLUC, KLrP, MGC104276, MGC126878
UniProt
Q9H227
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GBA3 Rabbit Polyclonal Antibody (orb583590) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_066024
Preservative
Lyophilized powder
AA Sequence
LTHYRFSLSWSRLLPDGTTGFINQKGIDYYNKIIDDLLKNGVTPIVTLYH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY424574 100 µg
alpha 2C Adrenergic Receptor (ADRA2C) (NM_000683) Human Over-expression Lysate
Sign In for Pricing
View Details 
AP20950PU-N 100 µg
HSP27 (HSPB1) pSer78/82 Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
BNC472096-500 1x 500 µL
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (R1/69), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
RTPL26 100 Apps
Viva 2-Steps RT-PCR Kit with M-MULV RT / Chromo MaxTaq DNA Polymerase, 100app
Sign In for Pricing
View Details