Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIPC3 Peptide - middle region

GIPC3 Peptide - middle region

Product Specifications

Product Name Alternative

C19orf64, DKFZp686J1198, FLJ40925, DFNB15, DFNB72, DFNB95

UniProt

Q8TF64

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GIPC3 Rabbit Polyclonal Antibody (orb330171) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_573568

Preservative

Lyophilized powder

AA Sequence

TLRLRSGGAATVEEAPSEFEEEASRKVDDLLESYMGIRDPELASTMVETS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab11A Rabbit pAb, IRDye 800CW conjugated
orb2873308 100 µL

Rab11A Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Zfp236 AAV siRNA Pooled Vector
50882164 1.0 µg

Zfp236 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Isodesmosine Antiserum
B2019196 1 mL

Isodesmosine Antiserum

Sign In for Pricing
View Details
(1a,5a,6a) -N-[1-Methyl-1- (1-methyl-1H-indazol-3-yl) ethyl]-3-azabicyclo[3.1.0]hexane-6-carboxamide
OR1037285-01 50 mg

(1a,5a,6a) -N-[1-Methyl-1- (1-methyl-1H-indazol-3-yl) ethyl]-3-azabicyclo[3.1.0]hexane-6-carboxamide

Sign In for Pricing
View Details
(1a,5a,6a) -N-[1-Methyl-1- (1-methyl-1H-indazol-3-yl) ethyl]-3-azabicyclo[3.1.0]hexane-6-carboxamide
OR1037285-02 100 mg

(1a,5a,6a) -N-[1-Methyl-1- (1-methyl-1H-indazol-3-yl) ethyl]-3-azabicyclo[3.1.0]hexane-6-carboxamide

Sign In for Pricing
View Details
HNRPC Peptide - N-terminal region
orb2017344 100 µg

HNRPC Peptide - N-terminal region

Sign In for Pricing
View Details