Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIPC3 Peptide - middle region

GIPC3 Peptide - middle region

Product Specifications

Product Name Alternative

C19orf64, DKFZp686J1198, FLJ40925, DFNB15, DFNB72, DFNB95

UniProt

Q8TF64

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GIPC3 Rabbit Polyclonal Antibody (orb330171) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_573568

Preservative

Lyophilized powder

AA Sequence

TLRLRSGGAATVEEAPSEFEEEASRKVDDLLESYMGIRDPELASTMVETS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human HPCAL1 Protein
MBS8249167-01 0.01 mg

Recombinant Human HPCAL1 Protein

Sign In for Pricing
View Details
Recombinant Human HPCAL1 Protein
MBS8249167-02 0.05 mg

Recombinant Human HPCAL1 Protein

Sign In for Pricing
View Details
Recombinant Human HPCAL1 Protein
MBS8249167-03 0.5 mg

Recombinant Human HPCAL1 Protein

Sign In for Pricing
View Details
Recombinant Human HPCAL1 Protein
MBS8249167-04 5x 0.5 mg

Recombinant Human HPCAL1 Protein

Sign In for Pricing
View Details
Human Daudi (B Lymphoblast) lysate
HCL-1224 100ug

Human Daudi (B Lymphoblast) lysate

Sign In for Pricing
View Details
OsGLO1 Antibody
abx018636 100 µL

OsGLO1 Antibody

Sign In for Pricing
View Details