Gm14277 Peptide - N-terminal region
Gm14277 Peptide - N-terminal region
Product Specifications
Product Name Alternative
OTTMUSG00000016169
UniProt
P62315
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Gm14277 Rabbit Polyclonal Antibody (orb324890) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_001481216
Preservative
Lyophilized powder
AA Sequence
VRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741948-100 1x 100 µL
Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042641-500 1x 500 µL
Prolactin (Pituitary Tumor Marker) (PRL/2641), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details