Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPN3 Peptide - C-terminal region

GPN3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ATPBD1C, MGC14560, MGC32810

UniProt

F5H759

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPN3 Rabbit Polyclonal Antibody (orb585435) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001157844

Preservative

Lyophilized powder

AA Sequence

LDPDMYSLLEDSTSDLRSKKFKKLTKAICGLIDDYSMVRFLPYDQSDEES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Noggin (NOG) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H8]
TA500029AM 100 µL

Noggin (NOG) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H8]

Sign In for Pricing
View Details
ALDH2 Recombinant Mouse Monoclonal Antibody [E4-D10-R]
HA601175 100 µL

ALDH2 Recombinant Mouse Monoclonal Antibody [E4-D10-R]

Sign In for Pricing
View Details
Angiopoietin like 4 (ANGPTL4) Human Gene Knockout Kit (CRISPR)
KN205651RB 1 Kit

Angiopoietin like 4 (ANGPTL4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Desmoglein-3 (Squamous Cell Marker) (DSG3/2837), CF568 conjugate, 0.1mg/mL
BNC682837-500 1x 500 µL

Desmoglein-3 (Squamous Cell Marker) (DSG3/2837), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bpifb3 Mouse Gene Knockout Kit (CRISPR)
KN502237 1 Kit

Bpifb3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Loricrin (LOR) Human Gene Knockout Kit (CRISPR)
KN423998 1 Kit

Loricrin (LOR) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details