Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPN3 Peptide - C-terminal region

GPN3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ATPBD1C, MGC14560, MGC32810

UniProt

F5H759

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPN3 Rabbit Polyclonal Antibody (orb585435) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001157844

Preservative

Lyophilized powder

AA Sequence

LDPDMYSLLEDSTSDLRSKKFKKLTKAICGLIDDYSMVRFLPYDQSDEES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CABP5 (NM_019855) Human Recombinant Protein
TP313946 20 µg

CABP5 (NM_019855) Human Recombinant Protein

Sign In for Pricing
View Details
Vmn1r176 Mouse Gene Knockout Kit (CRISPR)
KN518967 1 Kit

Vmn1r176 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RWDD3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8B3]
TA811754BM 100 µL

RWDD3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8B3]

Sign In for Pricing
View Details
Scfd2 Mouse Gene Knockout Kit (CRISPR)
KN515354 1 Kit

Scfd2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C11orf53 (NM_198498) Human Recombinant Protein
TP308142L 1 mg

C11orf53 (NM_198498) Human Recombinant Protein

Sign In for Pricing
View Details
Bcl-2 Antibody
F42666-0.08ML 0.08 mL

Bcl-2 Antibody

Sign In for Pricing
View Details