Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR87 Peptide - middle region

GPR87 Peptide - middle region

Product Specifications

Product Name Alternative

FKSG78, GPR95, KPG_002, MGC131898

UniProt

Q9BY21

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR87 Rabbit Polyclonal Antibody (orb578543) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076404

Preservative

Lyophilized powder

AA Sequence

NQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAQKILYYCKEITL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF692 (NM_001193328) Human Over-expression Lysate
LY434257 100 µg

ZNF692 (NM_001193328) Human Over-expression Lysate

Sign In for Pricing
View Details
Tyramide Amplification Kit with HRP Goat Anti-Mouse and Biotin-XX Tyramide
#33018 1 Kit

Tyramide Amplification Kit with HRP Goat Anti-Mouse and Biotin-XX Tyramide

Sign In for Pricing
View Details
OR9Q2 Human Gene Knockout Kit (CRISPR)
KN418049 1 Kit

OR9Q2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ethyl 6-(4-Chlorophenoxy)hexanoate
TRC-B126018-500MG 500 mg

Ethyl 6-(4-Chlorophenoxy)hexanoate

Sign In for Pricing
View Details
Pea3 (ETV4) Mouse Monoclonal Antibody [Clone ID: 1A2G3]
AM06250SU-N 100 µL

Pea3 (ETV4) Mouse Monoclonal Antibody [Clone ID: 1A2G3]

Sign In for Pricing
View Details
14-3-3 sigma Recombinant Rabbit monoclonal Antibody
HA723707F 100 µL

14-3-3 sigma Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details