Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR87 Peptide - middle region

GPR87 Peptide - middle region

Product Specifications

Product Name Alternative

FKSG78, GPR95, KPG_002, MGC131898

UniProt

Q9BY21

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR87 Rabbit Polyclonal Antibody (orb578543) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076404

Preservative

Lyophilized powder

AA Sequence

NQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAQKILYYCKEITL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 430 Anti-human CD4 Antibody *SK3*
10042030-AAT 100 Tests

IFluor® 430 Anti-human CD4 Antibody *SK3*

Sign In for Pricing
View Details
Diethyl Urethane
TRC-D556590-500MG 500 mg

Diethyl Urethane

Sign In for Pricing
View Details
DPP7 Antibody
OC-1498-01 50 μL

DPP7 Antibody

Sign In for Pricing
View Details
DPP7 Antibody
OC-1498-02 100 µL

DPP7 Antibody

Sign In for Pricing
View Details
DPP7 Antibody
OC-1498-03 1 mL

DPP7 Antibody

Sign In for Pricing
View Details
Cytokeratin 8 (H1 + TS1), Biotin conjugate, 0.1mg/mL
BNCB0687-100 1x 100 µL

Cytokeratin 8 (H1 + TS1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details