Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HASPIN Peptide - N-terminal region

HASPIN Peptide - N-terminal region

Product Specifications

Product Name Alternative

GSG2

UniProt

Q8TF76

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HASPIN Rabbit Polyclonal Antibody (orb326351) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114171

Preservative

Lyophilized powder

AA Sequence

SQEEATGGAKDTRMVHQTRASLRSVLFGLMNSGTPEDSEFRADGKNMRES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-FAM120C Antibody
CTA3973-01 30 µL

Anti-FAM120C Antibody

Sign In for Pricing
View Details
Anti-FAM120C Antibody
CTA3973-02 50 μL

Anti-FAM120C Antibody

Sign In for Pricing
View Details
Anti-FAM120C Antibody
CTA3973-03 100 µL

Anti-FAM120C Antibody

Sign In for Pricing
View Details
Anti-FAM120C Antibody
CTA3973-04 200 µL

Anti-FAM120C Antibody

Sign In for Pricing
View Details
Recombinant Fibronectin (FN)
SIPA021Bo01-01 10 µg

Recombinant Fibronectin (FN)

Sign In for Pricing
View Details
Recombinant Fibronectin (FN)
SIPA021Bo01-02 50 µg

Recombinant Fibronectin (FN)

Sign In for Pricing
View Details