Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF2E2 Peptide - N-terminal region

GTF2E2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FE, TF2E2, TFIIE-B

UniProt

P29084

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GTF2E2 Rabbit Polyclonal Antibody (orb576526) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002086

Preservative

Lyophilized powder

AA Sequence

MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]
E-AB-F1094UF-01 25 µg

PerCP Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]

Sign In for Pricing
View Details
PerCP Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]
E-AB-F1094UF-02 100 µg

PerCP Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]

Sign In for Pricing
View Details
Human CCDC102B activation kit by CRISPRa
GA112667 1 Kit

Human CCDC102B activation kit by CRISPRa

Sign In for Pricing
View Details
Peripherin Recombinant Rabbit monoclonal Antibody
HA751372 100 µL

Peripherin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse CD122/IL-2RB Protein (His Tag)
PKSM040485-01 50 µg

Recombinant Mouse CD122/IL-2RB Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse CD122/IL-2RB Protein (His Tag)
PKSM040485-02 1 mg

Recombinant Mouse CD122/IL-2RB Protein (His Tag)

Sign In for Pricing
View Details