Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HARS2 Peptide - N-terminal region

HARS2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HARSL, HARSR, HO3

UniProt

P49590

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HARS2 Rabbit Polyclonal Antibody (orb326438) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036340

Preservative

Lyophilized powder

AA Sequence

AWASLLSQLLRPPCASCTGAVRCQSQVAEAVLTSQLKAHQEKPNFIIKTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), CF594 conjugate, 0.1mg/mL
BNC942616-100 1x 100 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant PITPNB Antibody
RN-14404-01 50 μL

Recombinant PITPNB Antibody

Sign In for Pricing
View Details
Recombinant PITPNB Antibody
RN-14404-02 100 µL

Recombinant PITPNB Antibody

Sign In for Pricing
View Details
Recombinant PITPNB Antibody
RN-14404-03 1 mL

Recombinant PITPNB Antibody

Sign In for Pricing
View Details
KLF15 (NM_014079) Human Recombinant Protein
TP307523L 1 mg

KLF15 (NM_014079) Human Recombinant Protein

Sign In for Pricing
View Details
DMT1 (SLC11A2) (NM_000617) Human Over-expression Lysate
LY424604 100 µg

DMT1 (SLC11A2) (NM_000617) Human Over-expression Lysate

Sign In for Pricing
View Details