Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIST1H2BK Peptide - N-terminal region

HIST1H2BK Peptide - N-terminal region

Product Specifications

Product Name Alternative

H2B/S, H2BFAiii, H2BFT, MGC131989

UniProt

O60814

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_542160

Preservative

Lyophilized powder

AA Sequence

KKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OC/BGP (Osteocalcin) ELISA Kit
E-EL-H1343-01 24 Tests

Human OC/BGP (Osteocalcin) ELISA Kit

Sign In for Pricing
View Details
Human OC/BGP (Osteocalcin) ELISA Kit
E-EL-H1343-02 48 Tests

Human OC/BGP (Osteocalcin) ELISA Kit

Sign In for Pricing
View Details
Human OC/BGP (Osteocalcin) ELISA Kit
E-EL-H1343-03 96 Tests

Human OC/BGP (Osteocalcin) ELISA Kit

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Mouse F4/80 Antibody[CI:A3-1]
E-AB-F0995UR-01 25 µg

Elab Fluor® Violet 500 Anti-Mouse F4/80 Antibody[CI:A3-1]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Mouse F4/80 Antibody[CI:A3-1]
E-AB-F0995UR-02 100 µg

Elab Fluor® Violet 500 Anti-Mouse F4/80 Antibody[CI:A3-1]

Sign In for Pricing
View Details
Fmoc-L-allo-isoleucine
TRC-F594955-250MG 250 mg

Fmoc-L-allo-isoleucine

Sign In for Pricing
View Details