Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNF1B Peptide - C-terminal region

HNF1B Peptide - C-terminal region

Product Specifications

Product Name Alternative

FJHN, HNF1beta, HNF2, HPC11, LF-B3, LFB3, MODY5, TCF2, VHNF1

UniProt

P35680

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HNF1B Rabbit Polyclonal Antibody (orb574902) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000449

Preservative

Lyophilized powder

AA Sequence

QGNNEITSSSTISHHGNSAMVTSQSVLQQVSPASLDPGHNLLSPDGKMIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STN 704-052X105-B7541 Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)
251469 1 Card (1 Panel (s) x 1 Pack)

STN 704-052X105-B7541 Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Bovine Hepcidin (HEPC) ELISA Kit
MBS1603342-01 48 Well

Bovine Hepcidin (HEPC) ELISA Kit

Sign In for Pricing
View Details
Bovine Hepcidin (HEPC) ELISA Kit
MBS1603342-02 96 Well

Bovine Hepcidin (HEPC) ELISA Kit

Sign In for Pricing
View Details
Bovine Hepcidin (HEPC) ELISA Kit
MBS1603342-03 5x 96 Well

Bovine Hepcidin (HEPC) ELISA Kit

Sign In for Pricing
View Details
Bovine Hepcidin (HEPC) ELISA Kit
MBS1603342-04 10x 96 Well

Bovine Hepcidin (HEPC) ELISA Kit

Sign In for Pricing
View Details
Magnesium Ionophore VII
B2024720 10 mg

Magnesium Ionophore VII

Sign In for Pricing
View Details