Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxc12 Peptide - N-terminal region

Hoxc12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Hox-3.8

UniProt

Q8K5B8

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hoxc12 Rabbit Polyclonal Antibody (orb574311) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034593

Preservative

Lyophilized powder

AA Sequence

PLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLPWPSAEPCNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-DOK1 (Tyr362) Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-5289R-BF488 100 µL

Phospho-DOK1 (Tyr362) Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
2-Methoxy-N- (4-methylbenzenesulfonyl) benzamide
GDA58932-01 100 mg

2-Methoxy-N- (4-methylbenzenesulfonyl) benzamide

Sign In for Pricing
View Details
2-Methoxy-N- (4-methylbenzenesulfonyl) benzamide
GDA58932-02 1 g

2-Methoxy-N- (4-methylbenzenesulfonyl) benzamide

Sign In for Pricing
View Details
SUR1 Antibody (APC)
orb149979 100 µg

SUR1 Antibody (APC)

Sign In for Pricing
View Details
Tmem202 (NM_001109636) Rat Tagged ORF Clone
RR204846 10 µg

Tmem202 (NM_001109636) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human CGREF1/CGR11 (C-6His)
CA79-10ug 10 µg

Recombinant Human CGREF1/CGR11 (C-6His)

Sign In for Pricing
View Details