Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxc12 Peptide - N-terminal region

Hoxc12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Hox-3.8

UniProt

Q8K5B8

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hoxc12 Rabbit Polyclonal Antibody (orb574311) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034593

Preservative

Lyophilized powder

AA Sequence

PLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLPWPSAEPCNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Neisseria Gonorrhoeae dcd Protein (aa 1-188) (strain ATCC 700825 / FA 1090)
VAng-Wyb2502-500gEcoli 500 µg (E. coli)

Recombinant Neisseria Gonorrhoeae dcd Protein (aa 1-188) (strain ATCC 700825 / FA 1090)

Sign In for Pricing
View Details
RARS ELISA Kit (Human)
OKCD01732-96W 96 Well

RARS ELISA Kit (Human)

Sign In for Pricing
View Details
Ccl9 Polyclonal Antibody
A53404-100 100 µL

Ccl9 Polyclonal Antibody

Sign In for Pricing
View Details
DNAL1 Blocking Peptide
MBS824296-01 1 mg

DNAL1 Blocking Peptide

Sign In for Pricing
View Details
DNAL1 Blocking Peptide
MBS824296-02 5 mg

DNAL1 Blocking Peptide

Sign In for Pricing
View Details
DNAL1 Blocking Peptide
MBS824296-03 5x 5 mg

DNAL1 Blocking Peptide

Sign In for Pricing
View Details