Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSDL1 Peptide - N-terminal region

HSDL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC125994, MGC125995, MGC126032, SDR12C3

UniProt

Q3SXM5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSDL1 Rabbit Polyclonal Antibody (orb584743) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113651

Preservative

Lyophilized powder

AA Sequence

SRNEEKLQVVAKDIADTYKVETDIIVADFSSGREIYLPIREALKDKDVGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) lysS Polyclonal Antibody
MBS7162940 Inquire

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) lysS Polyclonal Antibody

Sign In for Pricing
View Details
Compound NP-016290
T129558-01 10 mg

Compound NP-016290

Sign In for Pricing
View Details
Compound NP-016290
T129558-02 1 g

Compound NP-016290

Sign In for Pricing
View Details
Compound NP-016290
T129558-03 1 mg

Compound NP-016290

Sign In for Pricing
View Details
Compound NP-016290
T129558-04 50 mg

Compound NP-016290

Sign In for Pricing
View Details
Compound NP-016290
T129558-05 5 mg

Compound NP-016290

Sign In for Pricing
View Details