Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSDL1 Peptide - N-terminal region

HSDL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC125994, MGC125995, MGC126032, SDR12C3

UniProt

Q3SXM5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSDL1 Rabbit Polyclonal Antibody (orb584743) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113651

Preservative

Lyophilized powder

AA Sequence

SRNEEKLQVVAKDIADTYKVETDIIVADFSSGREIYLPIREALKDKDVGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPIH Antibody
A31761-50UG 50 µg

PPIH Antibody

Sign In for Pricing
View Details
Recombinant Escherichia coli Heme exporter protein C (ccmC)
MBS7010977-01 0.02 mg

Recombinant Escherichia coli Heme exporter protein C (ccmC)

Sign In for Pricing
View Details
Recombinant Escherichia coli Heme exporter protein C (ccmC)
MBS7010977-02 0.1 mg

Recombinant Escherichia coli Heme exporter protein C (ccmC)

Sign In for Pricing
View Details
Recombinant Escherichia coli Heme exporter protein C (ccmC)
MBS7010977-03 5x 0.1 mg

Recombinant Escherichia coli Heme exporter protein C (ccmC)

Sign In for Pricing
View Details
R-(-)-Deprenyl Hydrochloride
TRC-D288641-5G 5 g

R-(-)-Deprenyl Hydrochloride

Sign In for Pricing
View Details
PTrem2-Fluc Plasmid
PVT77576 2 µg

PTrem2-Fluc Plasmid

Sign In for Pricing
View Details