Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IDS Peptide - N-terminal region

IDS Peptide - N-terminal region

Product Specifications

Product Name Alternative

MPS2, SIDS

UniProt

P22304

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IDS Rabbit Polyclonal Antibody (orb333732) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000193

Preservative

Lyophilized powder

AA Sequence

SFPPYHPSSEKYENTKTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5AR1 Antibody
MBS8515803-01 0.1 mg

OR5AR1 Antibody

Sign In for Pricing
View Details
OR5AR1 Antibody
MBS8515803-02 0.1 mL (AF635)

OR5AR1 Antibody

Sign In for Pricing
View Details
OR5AR1 Antibody
MBS8515803-03 0.1 mL (AF610)

OR5AR1 Antibody

Sign In for Pricing
View Details
OR5AR1 Antibody
MBS8515803-04 0.1 mL (AF405S)

OR5AR1 Antibody

Sign In for Pricing
View Details
OR5AR1 Antibody
MBS8515803-05 0.1 mL (AF405L)

OR5AR1 Antibody

Sign In for Pricing
View Details
OR5AR1 Antibody
MBS8515803-06 0.1 mL (AF546)

OR5AR1 Antibody

Sign In for Pricing
View Details