Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1F10 Peptide - middle region

IL1F10 Peptide - middle region

Product Specifications

Product Name Alternative

FIL1-theta, FKSG75, IL-1HY2, IL1-theta, MGC119831, MGC119832, MGC119833

UniProt

Q8WWZ1

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL1F10 Rabbit Polyclonal Antibody (orb584627) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115945

Preservative

Lyophilized powder

AA Sequence

SRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster S100 Calcium Binding Protein A8 ELISA Kit
MBS005486-01 48 Well

Hamster S100 Calcium Binding Protein A8 ELISA Kit

Sign In for Pricing
View Details
Hamster S100 Calcium Binding Protein A8 ELISA Kit
MBS005486-02 96 Well

Hamster S100 Calcium Binding Protein A8 ELISA Kit

Sign In for Pricing
View Details
Hamster S100 Calcium Binding Protein A8 ELISA Kit
MBS005486-03 5x 96 Well

Hamster S100 Calcium Binding Protein A8 ELISA Kit

Sign In for Pricing
View Details
Hamster S100 Calcium Binding Protein A8 ELISA Kit
MBS005486-04 10x 96 Well

Hamster S100 Calcium Binding Protein A8 ELISA Kit

Sign In for Pricing
View Details
GAD2 (Glutamic Acid Decarboxylase 2, GAD65, MGC161605, MGC161607) (MaxLight 405)
MBS6418020-01 0.1 mL

GAD2 (Glutamic Acid Decarboxylase 2, GAD65, MGC161605, MGC161607) (MaxLight 405)

Sign In for Pricing
View Details
GAD2 (Glutamic Acid Decarboxylase 2, GAD65, MGC161605, MGC161607) (MaxLight 405)
MBS6418020-02 5x 0.1 mL

GAD2 (Glutamic Acid Decarboxylase 2, GAD65, MGC161605, MGC161607) (MaxLight 405)

Sign In for Pricing
View Details