Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1F10 Peptide - middle region

IL1F10 Peptide - middle region

Product Specifications

Product Name Alternative

FIL1-theta, FKSG75, IL-1HY2, IL1-theta, MGC119831, MGC119832, MGC119833

UniProt

Q8WWZ1

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL1F10 Rabbit Polyclonal Antibody (orb584627) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115945

Preservative

Lyophilized powder

AA Sequence

SRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ggt6 3'UTR Lenti-reporter-Luc Vector
21480084 1.0 µg

Ggt6 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Cytokeratin 4 Recombinant Antibody, PerCP Conjugated
bsm-52062R-PerCP 100 µL

Cytokeratin 4 Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
ADH5 (Alcohol Dehydrogenase 5 (Class III), chi Polypeptide, ADH-3, ADHX, FDH, GSNOR) (HRP)
243115-HRP 100 µL

ADH5 (Alcohol Dehydrogenase 5 (Class III), chi Polypeptide, ADH-3, ADHX, FDH, GSNOR) (HRP)

Sign In for Pricing
View Details
Sodium Alginate
297745-01 250 g

Sodium Alginate

Sign In for Pricing
View Details
Sodium Alginate
297745-02 1 Kg

Sodium Alginate

Sign In for Pricing
View Details
Sodium Alginate
297745-03 5 Kg

Sodium Alginate

Sign In for Pricing
View Details