Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IMPDH2 Peptide - N-terminal region

IMPDH2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

IMPD2, IMPDH-II

UniProt

P12268

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IMPDH2 Rabbit Polyclonal Antibody (orb330749) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_000875

Preservative

Lyophilized powder

AA Sequence

MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dog Spinal cord Total Protein
DT-230 0.5 mg

Dog Spinal cord Total Protein

Sign In for Pricing
View Details
PDE4A CRISPR Activation Plasmid (m2)
sc-422160-ACT-2 20 µg

PDE4A CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Customized NAP1;2 Antibody
orb841154 2 mg

Customized NAP1;2 Antibody

Sign In for Pricing
View Details
4-hydroxy-3- (methylthio) -4,5,6,7-tetrahydro-2-benzothiophene-1-carbohydrazide
OR1002860-01 1 mg

4-hydroxy-3- (methylthio) -4,5,6,7-tetrahydro-2-benzothiophene-1-carbohydrazide

Sign In for Pricing
View Details
4-hydroxy-3- (methylthio) -4,5,6,7-tetrahydro-2-benzothiophene-1-carbohydrazide
OR1002860-02 5 mg

4-hydroxy-3- (methylthio) -4,5,6,7-tetrahydro-2-benzothiophene-1-carbohydrazide

Sign In for Pricing
View Details
4-hydroxy-3- (methylthio) -4,5,6,7-tetrahydro-2-benzothiophene-1-carbohydrazide
OR1002860-03 10 mg

4-hydroxy-3- (methylthio) -4,5,6,7-tetrahydro-2-benzothiophene-1-carbohydrazide

Sign In for Pricing
View Details