Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IQCD Peptide - middle region

IQCD Peptide - middle region

Product Specifications

Product Name Alternative

4933433C09Rik

UniProt

Q96DY2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IQCD Rabbit Polyclonal Antibody (orb581773) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612460

Preservative

Lyophilized powder

AA Sequence

CLKEKERQLQEQKEAEEEGWLRDRLLSIELQKSSLSPLMQQIKDSTKNVL

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syngr4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7215805 3x 1.0 µg

Syngr4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) SMR1 Polyclonal Antibody
MBS7147739 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) SMR1 Polyclonal Antibody

Sign In for Pricing
View Details
Shisa6 Mouse shRNA Plasmid (Locus ID 380702)
TR508561 1 Kit

Shisa6 Mouse shRNA Plasmid (Locus ID 380702)

Sign In for Pricing
View Details
ANKFY1 Human Over-expression Lysate
orb1348907 100 µg

ANKFY1 Human Over-expression Lysate

Sign In for Pricing
View Details
GENLISA Human Tsukushin (TSK) ELISA
KBH17098 1x 96 Well

GENLISA Human Tsukushin (TSK) ELISA

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Rho-related protein racE (racE)
MBS1428163-01 0.02 mg (E-Coli)

Recombinant Dictyostelium discoideum Rho-related protein racE (racE)

Sign In for Pricing
View Details