Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15 Peptide - middle region

ISG15 Peptide - middle region

Product Specifications

Product Name Alternative

G1P2, IFI15, UCRP, IP17, hUCRP

UniProt

P05161

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ISG15 Rabbit Polyclonal Antibody (orb584319) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_005092

Preservative

Lyophilized powder

AA Sequence

EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPB3 (NM_006308) Human Recombinant Protein
TP320525L 1 mg

HSPB3 (NM_006308) Human Recombinant Protein

Sign In for Pricing
View Details
Hexanoic-d11 Acid
TRC-H265065-5MG 5 mg

Hexanoic-d11 Acid

Sign In for Pricing
View Details
Tenm3 Mouse Gene Knockout Kit (CRISPR)
KN517408 1 Kit

Tenm3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mini Dry Bath Incubator BDMI-105
BDMI-105 1 Unit

Mini Dry Bath Incubator BDMI-105

Sign In for Pricing
View Details
ZNF626 Human Gene Knockout Kit (CRISPR)
KN418417 1 Kit

ZNF626 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ang5 Mouse Gene Knockout Kit (CRISPR)
KN501232 1 Kit

Ang5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details