Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15 Peptide - middle region

ISG15 Peptide - middle region

Product Specifications

Product Name Alternative

G1P2, IFI15, UCRP, IP17, hUCRP

UniProt

P05161

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ISG15 Rabbit Polyclonal Antibody (orb584319) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_005092

Preservative

Lyophilized powder

AA Sequence

EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fenamiphos Sulfoxide
TRC-F245720-250MG 250 mg

Fenamiphos Sulfoxide

Sign In for Pricing
View Details
Pure Erythrina cristagalli Lectin (Coral Tree) -ECA-
L-5901-5 5 mg

Pure Erythrina cristagalli Lectin (Coral Tree) -ECA-

Sign In for Pricing
View Details
GAD1 Polyclonal Antibody
E-AB-17390-01 20 µL

GAD1 Polyclonal Antibody

Sign In for Pricing
View Details
GAD1 Polyclonal Antibody
E-AB-17390-02 60 µL

GAD1 Polyclonal Antibody

Sign In for Pricing
View Details
GAD1 Polyclonal Antibody
E-AB-17390-03 120 µL

GAD1 Polyclonal Antibody

Sign In for Pricing
View Details
GAD1 Polyclonal Antibody
E-AB-17390-04 200 µL

GAD1 Polyclonal Antibody

Sign In for Pricing
View Details