Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITPRIP Peptide - C-terminal region

ITPRIP Peptide - C-terminal region

Product Specifications

Product Name Alternative

DANGER, KIAA1754, bA127L20, bA127L20.2, RP11-127L20.4

UniProt

Q8IWB1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITPRIP Rabbit Polyclonal Antibody (orb584839) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_203755

Preservative

Lyophilized powder

AA Sequence

EPLNLFRPFVLQRSLYRKTLDSFYEMLKNAPALISEYSLHVPSDQPTPKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Polyclonal anti-Human Coagulation Factor XIV (Protein C)
hAP-5799 50 µg

Sheep Polyclonal anti-Human Coagulation Factor XIV (Protein C)

Sign In for Pricing
View Details
COX17 Polyclonal Antibody
ANT-11626-100ug 100 µg

COX17 Polyclonal Antibody

Sign In for Pricing
View Details
CCDC80 ORF Vector (Human) (pORF)
15312011 1.0 µg DNA

CCDC80 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Biotinylated Recombinant Human Notch 2 Protein, Avi His Tag
E40KMP2061 20 µg

Biotinylated Recombinant Human Notch 2 Protein, Avi His Tag

Sign In for Pricing
View Details
2-PADQZ hydrochloride
MBS3615778-01 5 mg

2-PADQZ hydrochloride

Sign In for Pricing
View Details
2-PADQZ hydrochloride
MBS3615778-02 10 mg

2-PADQZ hydrochloride

Sign In for Pricing
View Details