Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNIP4 Peptide - N-terminal region

KCNIP4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CALP, KCHIP4, MGC44947

UniProt

Q6PIL6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNIP4 Rabbit Polyclonal Antibody (orb575251) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079497

Preservative

Lyophilized powder

AA Sequence

NVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF217 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G5]
TA809028AM 100 µL

ZNF217 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G5]

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS701905 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
INPP5E Rabbit Polyclonal Antibody
TA377518 100 µL

INPP5E Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Factor XIII (F13B) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H10]
TA805993AM 100 µL

Factor XIII (F13B) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H10]

Sign In for Pricing
View Details
One-step TUNEL Flow Cytometry Apoptosis Kit (Red, Elab Fluor® 594)
E-CK-A422-01 20 Assays

One-step TUNEL Flow Cytometry Apoptosis Kit (Red, Elab Fluor® 594)

Sign In for Pricing
View Details
One-step TUNEL Flow Cytometry Apoptosis Kit (Red, Elab Fluor® 594)
E-CK-A422-02 100 Assays

One-step TUNEL Flow Cytometry Apoptosis Kit (Red, Elab Fluor® 594)

Sign In for Pricing
View Details