Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNIP4 Peptide - N-terminal region

KCNIP4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CALP, KCHIP4, MGC44947

UniProt

Q6PIL6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNIP4 Rabbit Polyclonal Antibody (orb575251) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079497

Preservative

Lyophilized powder

AA Sequence

NVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPLANE1 Human Gene Knockout Kit (CRISPR)
KN415617 1 Kit

CPLANE1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SPTAN1 Polyclonal Antibody
E-AB-40268-01 25 µL

SPTAN1 Polyclonal Antibody

Sign In for Pricing
View Details
SPTAN1 Polyclonal Antibody
E-AB-40268-02 100 µL

SPTAN1 Polyclonal Antibody

Sign In for Pricing
View Details
TOR1AIP1 (NM_015602) Human Recombinant Protein
TP321686 20 µg

TOR1AIP1 (NM_015602) Human Recombinant Protein

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/826), CF640R conjugate, 0.1mg/mL
BNC400826-100 1x 100 µL

Ep-CAM / CD326 (EGP40/826), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 (SARS-CoV-2) S protein RBD (C-mFc-6His tag)
PKSV030276-01 50 µg

Recombinant SARS-CoV-2 (SARS-CoV-2) S protein RBD (C-mFc-6His tag)

Sign In for Pricing
View Details