CFAP97 Peptide - middle region
CFAP97 Peptide - middle region
Product Specifications
Product Name Alternative
Hmw, KIAA1430
UniProt
Q9P2B7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CFAP97 Rabbit Polyclonal Antibody (orb583574) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_065878
Preservative
Lyophilized powder
AA Sequence
NMGYLNSSPLSRRARSTLGQYSPLRASRTSSATSGLSCRSERSAVDPSSG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2934537-01 20 µg
Recombinant Azotobacter vinelandii NADH-quinone oxidoreductase subunit K (nuoK)
Sign In for Pricing
View Details orb2934537-02 100 µg
Recombinant Azotobacter vinelandii NADH-quinone oxidoreductase subunit K (nuoK)
Sign In for Pricing
View Details 
PC1005412-01 100 mg
(R) -5-Bromo-3- (1- (2,6-dichloro-3-fluorophenyl) ethoxy) -2-nitropyridine
Sign In for Pricing
View Details PC1005412-02 250 mg
(R) -5-Bromo-3- (1- (2,6-dichloro-3-fluorophenyl) ethoxy) -2-nitropyridine
Sign In for Pricing
View Details