CFAP97 Peptide - middle region
CFAP97 Peptide - middle region
Product Specifications
Product Name Alternative
Hmw, KIAA1430
UniProt
Q9P2B7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CFAP97 Rabbit Polyclonal Antibody (orb583574) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_065878
Preservative
Lyophilized powder
AA Sequence
NMGYLNSSPLSRRARSTLGQYSPLRASRTSSATSGLSCRSERSAVDPSSG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1319695-01 0.02 mg (E-Coli)
Recombinant Robinia pseudoacacia Bark agglutinin I polypeptide A
Sign In for Pricing
View Details MBS1319695-02 0.1 mg (E-Coli)
Recombinant Robinia pseudoacacia Bark agglutinin I polypeptide A
Sign In for Pricing
View Details MBS1319695-03 0.02 mg (Yeast)
Recombinant Robinia pseudoacacia Bark agglutinin I polypeptide A
Sign In for Pricing
View Details MBS1319695-04 0.1 mg (Yeast)
Recombinant Robinia pseudoacacia Bark agglutinin I polypeptide A
Sign In for Pricing
View Details MBS1319695-05 0.02 mg (Baculovirus)
Recombinant Robinia pseudoacacia Bark agglutinin I polypeptide A
Sign In for Pricing
View Details MBS1319695-06 0.02 mg (Mammalian-Cell)
Recombinant Robinia pseudoacacia Bark agglutinin I polypeptide A
Sign In for Pricing
View Details