Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lap3 Peptide - N-terminal region

Lap3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2410015L10Rik, AA410100, Lap, Lapep, Pep-7, Pep-S, Pep7, Peps, LAP-3

UniProt

Q9CPY7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lap3 Rabbit Polyclonal Antibody (orb583306) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077754

Preservative

Lyophilized powder

AA Sequence

QDLELPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKVAVSAKLHGSGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARP14 inhibitor H10 50mg
A18616-50 50 mg

PARP14 inhibitor H10 50mg

Sign In for Pricing
View Details
CD331 Recombinant Protein
NCP0321-01 500 µg

CD331 Recombinant Protein

Sign In for Pricing
View Details
CD331 Recombinant Protein
NCP0321-02 1 mg

CD331 Recombinant Protein

Sign In for Pricing
View Details
C1orf156 (METTL18) (NM_033418) Human Tagged ORF Clone
RG202005 10 µg

C1orf156 (METTL18) (NM_033418) Human Tagged ORF Clone

Sign In for Pricing
View Details
Bche (NM_009738) Mouse Tagged Lenti ORF Clone
MR219194L4 10 µg

Bche (NM_009738) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
UBE2G2 (h) -PR
sc-76788-PR 10 µM - 20 µL

UBE2G2 (h) -PR

Sign In for Pricing
View Details