Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lap3 Peptide - N-terminal region

Lap3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2410015L10Rik, AA410100, Lap, Lapep, Pep-7, Pep-S, Pep7, Peps, LAP-3

UniProt

Q9CPY7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lap3 Rabbit Polyclonal Antibody (orb583306) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077754

Preservative

Lyophilized powder

AA Sequence

QDLELPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKVAVSAKLHGSGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDSN CRISPR Activation Plasmid (m)
sc-436451-ACT 20 µg

CDSN CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
StAR Rabbit Polyclonal Antibody
APRab00244-01 20 µL

StAR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
StAR Rabbit Polyclonal Antibody
APRab00244-02 50 µL

StAR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
StAR Rabbit Polyclonal Antibody
APRab00244-03 100 µL

StAR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
StAR Rabbit Polyclonal Antibody
APRab00244-04 200 µL

StAR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human metapneumovirus (strain HMPV/Homo sapiens/PER/CFI0320/2010/A) glycoprotein G Protein (His Tag)
E45O54952M2-100 100 µg

Human metapneumovirus (strain HMPV/Homo sapiens/PER/CFI0320/2010/A) glycoprotein G Protein (His Tag)

Sign In for Pricing
View Details