Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMAP1 Peptide - N-terminal region

SMAP1 Peptide - N-terminal region

Product Specifications

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SMAP1 Rabbit Polyclonal Antibody (orb326090) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_002727223

Preservative

Lyophilized powder

AA Sequence

MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Olfactory receptor 8B2 (OR8B2) ELISA Kit
GTR10333675 96 Well

Guinea Pig Olfactory receptor 8B2 (OR8B2) ELISA Kit

Sign In for Pricing
View Details
Ligularine
HY-122527 Inquire

Ligularine

Sign In for Pricing
View Details
SCAND1 (NM_016558) Human Tagged Lenti ORF Clone
RC204370L3 10 µg

SCAND1 (NM_016558) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Amyloid beta, 1-40 (Amyloid A4)
A2275-59T 400 µg

Amyloid beta, 1-40 (Amyloid A4)

Sign In for Pricing
View Details
Rabbit Polyclonal ARL15 Antibody [Alexa Fluor 532]
NBP1-77052AF532 0.1 mL

Rabbit Polyclonal ARL15 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
DHX38 Rabbit pAb
E2504341 100 µL

DHX38 Rabbit pAb

Sign In for Pricing
View Details